PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G14930.1
Common NameLOC102722403
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARR-B
Protein Properties Length: 695aa    MW: 76319.9 Da    PI: 6.1773
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G14930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like902.1e-28217270155
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+ Lt+e+v+SHLQkYRl
  OB06G14930.1 217 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKRILELMNVEKLTRENVASHLQKYRL 270
                   79*******************.********************************8 PP

2Response_reg76.41.1e-25281361109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ +++l+++l++ +y +v+++ ++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++ +ge +++ + +  Ga 
  OB06G14930.1  28 VLAVDDDPVCLKVLETLLRRCQY-HVTSTNQAITALKLLRENRdmFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSVNGETKTVMKGITHGAC 122
                   799********************.***************99999********************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel++
  OB06G14930.1 123 DYLLKPVRIEELRN 136
                   ************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363928.4E-2095695IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23005.8E-4125173No hitNo description
SuperFamilySSF521721.85E-3425151IPR011006CheY-like superfamily
SMARTSM004483.8E-3026138IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.27527142IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.2E-2328137IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.94E-2529141No hitNo description
PROSITE profilePS5129411.351214273IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-30215275IPR009057Homeodomain-like
SuperFamilySSF466891.47E-19215274IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-25217270IPR006447Myb domain, plants
PfamPF002491.3E-6219269IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 695 aa     Download sequence    Send to blast
MLLGAVRTEE RRGLMGRERD QFPVGMRVLA VDDDPVCLKV LETLLRRCQY HVTSTNQAIT  60
ALKLLRENRD MFDLVISDVH MPDMDGFKLL ELVGLEMDLP VIMLSVNGET KTVMKGITHG  120
ACDYLLKPVR IEELRNIWQH VVRRKFGNRE RNNLDISKDC NKPPTADTEH GPNQPTCGSS  180
DQNERVSKKR KEVHSEEDEE GDDNDFQEND EPSAAKKPRV VWSVELHRKF VAAVNQLGID  240
KAVPKRILEL MNVEKLTREN VASHLQKYRL YLKRLSAVAS QQASIVAAFG GRDPSFLHMG  300
AFEGLQSYQP FAPSTALPSF NPHGLLSRTS AAAAFGLQEL AASNTIQAVP GNVTISHCLE  360
ENQQTNLAQG LTATLGQPQL QQNWIHQENN GLSDVFSGSA LTNTLSTTLQ RVPSSSLPPQ  420
ELLECKQANV SMQPSIRIPT SSSGLLERTL GVSPNLGDSS ISQQGALPID GGFSADRLPL  480
HNSFDGTFAT KLDTSLAASH REIGQQGKFS VSMLVCPSDN LTLAKNAKTG DSSSGSTIML  540
PLDTARHSDY LQFGGSSNSM QKMDAQKQDH IQSSSNIWSS IPSPQVPADT QIYNTQNEKL  600
NSGSFNQNVG VHLADQANAS VSIVRQMKFD TRASEDKLKQ KNTYDFGNSK LQGGFNSNSC  660
NFDGLLNSII KVEKDDLPFM DNDLGCDLFP LGACI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-24213276164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1029590.0AK102959.1 Oryza sativa Japonica Group cDNA clone:J033115H14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655852.10.0PREDICTED: two-component response regulator ORR22
SwissprotQ5SML50.0ORR22_ORYSJ; Two-component response regulator ORR22
TrEMBLJ3MBU90.0J3MBU9_ORYBR; Uncharacterized protein
STRINGOB06G14930.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP18563894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-108response regulator 12